PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G13190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 200aa    MW: 22517.2 Da    PI: 5.7758
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G13190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.34.7e-3071231128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGf+F P+deel+ ++L++k++  +++  ++++++ ++ ++Pw+L+ k+ ++ ++wyfFs++ +        +r+  +g Wk     ++v+s
  OGLUM04G13190.1   7 LPPGFHFFPSDEELIIHFLRRKASLLPCQP-DIVPTLILNLYDPWELNGKALQSGNQWYFFSHATQ--------TRTSPNGHWKPIAD-ETVIS 90 
                      79*************************999.89**************976667789******9754........577889****9976.66667 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g +vglkktL+f+ g+  ++ kt+Wvmhey+l
  OGLUM04G13190.1  91 -GGCNVGLKKTLIFFIGEPFEAIKTNWVMHEYHL 123
                      .7999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-423164IPR003441NAC domain
PROSITE profilePS5100539.1317165IPR003441NAC domain
PfamPF023652.8E-208123IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAGASNLPPG FHFFPSDEEL IIHFLRRKAS LLPCQPDIVP TLILNLYDPW ELNGKALQSG  60
NQWYFFSHAT QTRTSPNGHW KPIADETVIS GGCNVGLKKT LIFFIGEPFE AIKTNWVMHE  120
YHLMDGSTNC SSSSTSSSSS KRSHKKKGHS DTESKNWVIC RVFESSYDSQ VSFHEEGTEL  180
SCLDEVFLSL DDYDEVSFAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-31617016170NO APICAL MERISTEM PROTEIN
1ut4_B2e-31617016170NO APICAL MERISTEM PROTEIN
1ut7_A2e-31617016170NO APICAL MERISTEM PROTEIN
1ut7_B2e-31617016170NO APICAL MERISTEM PROTEIN
3swm_A2e-31617019173NAC domain-containing protein 19
3swm_B2e-31617019173NAC domain-containing protein 19
3swm_C2e-31617019173NAC domain-containing protein 19
3swm_D2e-31617019173NAC domain-containing protein 19
3swp_A2e-31617019173NAC domain-containing protein 19
3swp_B2e-31617019173NAC domain-containing protein 19
3swp_C2e-31617019173NAC domain-containing protein 19
3swp_D2e-31617019173NAC domain-containing protein 19
4dul_A2e-31617016170NAC domain-containing protein 19
4dul_B2e-31617016170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2435850.0AK243585.1 Oryza sativa Japonica Group cDNA, clone: J100082O14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634043.11e-149PREDICTED: NAC transcription factor 29
SwissprotQ8GWK61e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0D9ZL291e-149A0A0D9ZL29_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0P9G51e-149A0A0E0P9G5_ORYRU; Uncharacterized protein
TrEMBLQ7XV601e-149Q7XV60_ORYSJ;
STRINGLOC_Os04g35660.11e-149(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-57xylem NAC domain 1